Lineage for d4icba_ (4icb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710068Family a.39.1.1: Calbindin D9K [47474] (2 proteins)
    made of two EF-hands only
  6. 2710069Protein Calbindin D9K [47475] (2 species)
  7. 2710070Species Cow (Bos taurus) [TaxId:9913] [47476] (20 PDB entries)
    Uniprot P02633
  8. 2710078Domain d4icba_: 4icb A: [17145]
    complexed with ca

Details for d4icba_

PDB Entry: 4icb (more details), 1.6 Å

PDB Description: proline cis-trans isomers in calbindin d9k observed by x-ray crystallography
PDB Compounds: (A:) calbindin d9k

SCOPe Domain Sequences for d4icba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4icba_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
mkspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdg
evsfeefqvlvkkisq

SCOPe Domain Coordinates for d4icba_:

Click to download the PDB-style file with coordinates for d4icba_.
(The format of our PDB-style files is described here.)

Timeline for d4icba_: