| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
| Protein automated matches [190590] (26 species) not a true protein |
| Species Oligobrachia mashikoi [TaxId:55676] [187601] (8 PDB entries) |
| Domain d2zs0b_: 2zs0 B: [171449] automated match to d1x9fb_ complexed with ca, cl, gol, hem, oxy |
PDB Entry: 2zs0 (more details), 1.6 Å
SCOPe Domain Sequences for d2zs0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zs0b_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
arsfdndawnscmnqivsgisg
Timeline for d2zs0b_: