Lineage for d2zs0a_ (2zs0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689508Species Oligobrachia mashikoi [TaxId:55676] [187601] (8 PDB entries)
  8. 2689509Domain d2zs0a_: 2zs0 A: [171448]
    automated match to d1x9fb_
    complexed with ca, cl, gol, hem, oxy

Details for d2zs0a_

PDB Entry: 2zs0 (more details), 1.6 Å

PDB Description: Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin
PDB Compounds: (A:) Extracellular giant hemoglobin major globin subunit A1

SCOPe Domain Sequences for d2zs0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zs0a_ a.1.1.0 (A:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
vcnrleqilvktqwaqsygeaenraafsrdlfselfniqgssralfsgvgvddmnsaaft
ahclrvtgalnrlisqldqqatinadlahlagqhasrnldasnfaamgqavmsvvpthld
cfnqhawgecyeriasgisg

SCOPe Domain Coordinates for d2zs0a_:

Click to download the PDB-style file with coordinates for d2zs0a_.
(The format of our PDB-style files is described here.)

Timeline for d2zs0a_: