Lineage for d2zr8a_ (2zr8 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1182707Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1182708Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1182709Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1182923Protein automated matches [190054] (8 species)
    not a true protein
  7. 1182934Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188093] (3 PDB entries)
  8. 1182937Domain d2zr8a_: 2zr8 A: [171447]
    automated match to d1v71a1
    complexed with mg, pdd

Details for d2zr8a_

PDB Entry: 2zr8 (more details), 2.2 Å

PDB Description: crystal structure of modified serine racemase complexed with serine
PDB Compounds: (A:) Uncharacterized protein C320.14

SCOPe Domain Sequences for d2zr8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zr8a_ c.79.1.1 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
lvlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrgalna
lsqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyggqvi
mydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfvclgg
ggllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtqhlgn
ytfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklknkrig
iiisggnvdieryahflsq

SCOPe Domain Coordinates for d2zr8a_:

Click to download the PDB-style file with coordinates for d2zr8a_.
(The format of our PDB-style files is described here.)

Timeline for d2zr8a_: