SCOPe 2.05: Domain d2zr1c_: 2zr1 C:

Lineage for d2zr1c_ (2zr1 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Abrus precatorius [TaxId:3816] [189038] (1 PDB entry)

8. Domain d2zr1c_: 2zr1 C: [171446]
   Other proteins in same PDB: d2zr1b1, d2zr1b2, d2zr1d1, d2zr1d2
   automated match to d2q3na1
   complexed with nag, ndg

Details for d2zr1c_

PDB Entry: 2zr1, 2.6 Å

PDB Description: agglutinin from abrus precatorius

PDB Compounds: (C:) Agglutinin-1 chain A

SCOPe Domain Sequences for d2zr1c_:

Sequence; same for both SEQRES and ATOM records:

>d2zr1c_ d.165.1.1 (C:) automated matches {Abrus precatorius [TaxId: 3816]}
qdpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdt
vsiqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwah
qsrqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsn
raafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsala
lmlfvcnpln

Timeline for d2zr1c_:

• d2zr1c_ first appeared in SCOPe 2.01
  
• d2zr1c_ appears in SCOPe 2.04
  
• d2zr1c_ appears in SCOPe 2.06
  
• d2zr1c_ appears in the current release, SCOPe 2.08