Lineage for d2zqrf_ (2zqr F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853090Protein AUH protein [69440] (1 species)
    an RNA-binding homologue of enoyl-CoA hydratase
  7. 2853091Species Human (Homo sapiens) [TaxId:9606] [69441] (3 PDB entries)
  8. 2853109Domain d2zqrf_: 2zqr F: [171441]
    automated match to d1hzda_

Details for d2zqrf_

PDB Entry: 2zqr (more details), 2.5 Å

PDB Description: Crystal structure of AUH without RNA
PDB Compounds: (F:) Methylglutaconyl-CoA hydratase

SCOPe Domain Sequences for d2zqrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqrf_ c.14.1.3 (F:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
tiptkdrlegllafkekrpprykge

SCOPe Domain Coordinates for d2zqrf_:

Click to download the PDB-style file with coordinates for d2zqrf_.
(The format of our PDB-style files is described here.)

Timeline for d2zqrf_: