Lineage for d2zqrd_ (2zqr D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436152Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2436181Protein AUH protein [69440] (1 species)
    an RNA-binding homologue of enoyl-CoA hydratase
  7. 2436182Species Human (Homo sapiens) [TaxId:9606] [69441] (3 PDB entries)
  8. 2436198Domain d2zqrd_: 2zqr D: [171439]
    automated match to d1hzda_

Details for d2zqrd_

PDB Entry: 2zqr (more details), 2.5 Å

PDB Description: Crystal structure of AUH without RNA
PDB Compounds: (D:) Methylglutaconyl-CoA hydratase

SCOPe Domain Sequences for d2zqrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqrd_ c.14.1.3 (D:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}
delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
tiptkdrlegllafkekrpprykge

SCOPe Domain Coordinates for d2zqrd_:

Click to download the PDB-style file with coordinates for d2zqrd_.
(The format of our PDB-style files is described here.)

Timeline for d2zqrd_: