![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein automated matches [190068] (12 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [189037] (2 PDB entries) |
![]() | Domain d2zqjb_: 2zqj B: [171428] automated match to d1izoa_ complexed with hem |
PDB Entry: 2zqj (more details), 2.9 Å
SCOPe Domain Sequences for d2zqjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqjb_ a.104.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk
Timeline for d2zqjb_: