Lineage for d2zqja_ (2zqj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005442Species Bacillus subtilis [TaxId:1423] [189037] (2 PDB entries)
  8. 2005446Domain d2zqja_: 2zqj A: [171427]
    automated match to d1izoa_
    complexed with hem

Details for d2zqja_

PDB Entry: 2zqj (more details), 2.9 Å

PDB Description: Substrate-Free Form of Cytochrome P450BSbeta
PDB Compounds: (A:) Cytochrome P450 152A1

SCOPe Domain Sequences for d2zqja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqja_ a.104.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq
rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr
wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr
arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv
aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn
cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg
egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk

SCOPe Domain Coordinates for d2zqja_:

Click to download the PDB-style file with coordinates for d2zqja_.
(The format of our PDB-style files is described here.)

Timeline for d2zqja_: