Lineage for d2zqba_ (2zqb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493669Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2493915Protein automated matches [190266] (7 species)
    not a true protein
  7. 2493934Species Shewanella oneidensis [TaxId:70863] [188955] (1 PDB entry)
  8. 2493935Domain d2zqba_: 2zqb A: [171421]
    automated match to d1rbra_
    complexed with so4; mutant

Details for d2zqba_

PDB Entry: 2zqb (more details), 2.49 Å

PDB Description: crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations
PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d2zqba_:

Sequence, based on SEQRES records: (download)

>d2zqba_ c.55.3.1 (A:) automated matches {Shewanella oneidensis [TaxId: 70863]}
elklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealk
epckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrw
vkghaghaenerchqlaraaaeanptqidtgy

Sequence, based on observed residues (ATOM records): (download)

>d2zqba_ c.55.3.1 (A:) automated matches {Shewanella oneidensis [TaxId: 70863]}
elklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealk
epckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrw
vkghaenerchqlaraaaeanptqidtgy

SCOPe Domain Coordinates for d2zqba_:

Click to download the PDB-style file with coordinates for d2zqba_.
(The format of our PDB-style files is described here.)

Timeline for d2zqba_: