SCOPe 2.06: Domain d2zqba_: 2zqb A:

Lineage for d2zqba_ (2zqb A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein automated matches [190266] (7 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:70863] [188955] (1 PDB entry)

8. Domain d2zqba_: 2zqb A: [171421]
   automated match to d1rbra_
   complexed with so4; mutant

Details for d2zqba_

PDB Entry: 2zqb, 2.49 Å

PDB Description: crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations

PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d2zqba_:

Sequence, based on SEQRES records:

>d2zqba_ c.55.3.1 (A:) automated matches {Shewanella oneidensis [TaxId: 70863]}
elklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealk
epckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrw
vkghaghaenerchqlaraaaeanptqidtgy

Sequence, based on observed residues (ATOM records):

>d2zqba_ c.55.3.1 (A:) automated matches {Shewanella oneidensis [TaxId: 70863]}
elklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealk
epckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrw
vkghaenerchqlaraaaeanptqidtgy

Timeline for d2zqba_:

• d2zqba_ first appeared in SCOPe 2.01
  
• d2zqba_ appears in SCOPe 2.05
  
• d2zqba_ appears in SCOPe 2.07
  
• d2zqba_ appears in the current release, SCOPe 2.08