Lineage for d2zqaa_ (2zqa A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054569Protein beta-Lactamase, class A [56606] (15 species)
  7. 1054628Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (15 PDB entries)
  8. 1054630Domain d2zqaa_: 2zqa A: [171420]
    automated match to d1iyqa_
    complexed with pcz, so4; mutant

Details for d2zqaa_

PDB Entry: 2zqa (more details), 0.95 Å

PDB Description: cefotaxime acyl-intermediate structure of class a beta-lacta toho-1 e166a/r274n/r276n triple mutant
PDB Compounds: (A:) beta-lactamase toho-1

SCOPe Domain Sequences for d2zqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqaa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
vtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraql
vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
qkaenrndilaaaakivthgf

SCOPe Domain Coordinates for d2zqaa_:

Click to download the PDB-style file with coordinates for d2zqaa_.
(The format of our PDB-style files is described here.)

Timeline for d2zqaa_: