SCOPe 2.05: Domain d1am9c_: 1am9 C:

Lineage for d1am9c_ (1am9 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)

6. Protein SREBP-1a [47470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47471] (1 PDB entry)

8. Domain d1am9c_: 1am9 C: [17142]
   protein/DNA complex; complexed with mg

Details for d1am9c_

PDB Entry: 1am9, 2.3 Å

PDB Description: human srebp-1a bound to ldl receptor promoter

PDB Compounds: (C:) protein (sterol regulatory element binding protein 1a)

SCOPe Domain Sequences for d1am9c_:

Sequence; same for both SEQRES and ATOM records:

>d1am9c_ a.38.1.1 (C:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]}
qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
klkqenlslrtavhkskslkdl

Timeline for d1am9c_:

• d1am9c_ first appeared (with stable ids) in SCOP 1.55
  
• d1am9c_ appears in SCOPe 2.04
  
• d1am9c_ appears in SCOPe 2.06
  
• d1am9c_ appears in the current release, SCOPe 2.08