| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
| Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein beta-Lactamase, class A [56606] (16 species) |
| Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (27 PDB entries) |
| Domain d2zq7a_: 2zq7 A: [171417] automated match to d1iyqa_ complexed with so4; mutant |
PDB Entry: 2zq7 (more details), 0.94 Å
SCOPe Domain Sequences for d2zq7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zq7a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
vtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraql
vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
qkaenrndilaaaakivthgf
Timeline for d2zq7a_: