Lineage for d2zpxb_ (2zpx B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943163Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 943164Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 943165Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 943346Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 943347Species Human (Homo sapiens) [TaxId:9606] [49849] (10 PDB entries)
  8. 943371Domain d2zpxb_: 2zpx B: [171413]
    automated match to d1a8ma_
    mutant

Details for d2zpxb_

PDB Entry: 2zpx (more details), 2.83 Å

PDB Description: tnf receptor subtype one-selective tnf mutant with antagonistic activity; r1anttnf-t8
PDB Compounds: (B:) Tumor necrosis factor

SCOPe Domain Sequences for d2zpxb_:

Sequence, based on SEQRES records: (download)

>d2zpxb_ b.22.1.1 (B:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisritpainrpvnllsairspcqretpegaeanpwyepiylggvfqle
pgdrlsaeinrpdyldfaesgqvyfgiial

Sequence, based on observed residues (ATOM records): (download)

>d2zpxb_ b.22.1.1 (B:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisritpainrpvnllsairspcqanpwyepiylggvfqlepgdrlsae
inrpdyldfaesgqvyfgiial

SCOPe Domain Coordinates for d2zpxb_:

Click to download the PDB-style file with coordinates for d2zpxb_.
(The format of our PDB-style files is described here.)

Timeline for d2zpxb_: