Lineage for d2zpxa_ (2zpx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777391Protein Tumor necrosis factor (TNF) [49848] (3 species)
  7. 2777392Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries)
  8. 2777484Domain d2zpxa_: 2zpx A: [171412]
    automated match to d1a8ma_
    mutant

Details for d2zpxa_

PDB Entry: 2zpx (more details), 2.83 Å

PDB Description: tnf receptor subtype one-selective tnf mutant with antagonistic activity; r1anttnf-t8
PDB Compounds: (A:) Tumor necrosis factor

SCOPe Domain Sequences for d2zpxa_:

Sequence, based on SEQRES records: (download)

>d2zpxa_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisritpainrpvnllsairspcqretpegaeanpwyepiylggvfqle
pgdrlsaeinrpdyldfaesgqvyfgiial

Sequence, based on observed residues (ATOM records): (download)

>d2zpxa_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisritpainrpvnllsairspcqanpwyepiylggvfqlepgdrlsae
inrpdyldfaesgqvyfgiial

SCOPe Domain Coordinates for d2zpxa_:

Click to download the PDB-style file with coordinates for d2zpxa_.
(The format of our PDB-style files is described here.)

Timeline for d2zpxa_: