Lineage for d1am9b_ (1am9 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355126Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 355127Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 355128Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 355160Protein SREBP-1a [47470] (1 species)
  7. 355161Species Human (Homo sapiens) [TaxId:9606] [47471] (1 PDB entry)
  8. 355163Domain d1am9b_: 1am9 B: [17141]

Details for d1am9b_

PDB Entry: 1am9 (more details), 2.3 Å

PDB Description: human srebp-1a bound to ldl receptor promoter

SCOP Domain Sequences for d1am9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1am9b_ a.38.1.1 (B:) SREBP-1a {Human (Homo sapiens)}
srgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnqk
lkqenlslrtavhks

SCOP Domain Coordinates for d1am9b_:

Click to download the PDB-style file with coordinates for d1am9b_.
(The format of our PDB-style files is described here.)

Timeline for d1am9b_: