Lineage for d2zprb_ (2zpr B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2796829Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [189036] (3 PDB entries)
  8. 2796831Domain d2zprb_: 2zpr B: [171408]
    automated match to d1hj8a_
    complexed with ben, ca

Details for d2zprb_

PDB Entry: 2zpr (more details), 1.75 Å

PDB Description: Crystal structure of anionic trypsin isoform 2 from chum salmon
PDB Compounds: (B:) anionic trypsin

SCOPe Domain Sequences for d2zprb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zprb_ b.47.1.2 (B:) automated matches {Chum salmon (Oncorhynchus keta) [TaxId: 8018]}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvavrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
wgntmsstadgdklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmat

SCOPe Domain Coordinates for d2zprb_:

Click to download the PDB-style file with coordinates for d2zprb_.
(The format of our PDB-style files is described here.)

Timeline for d2zprb_: