Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [189036] (3 PDB entries) |
Domain d2zpra_: 2zpr A: [171407] automated match to d1hj8a_ complexed with ben, ca |
PDB Entry: 2zpr (more details), 1.75 Å
SCOPe Domain Sequences for d2zpra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zpra_ b.47.1.2 (A:) automated matches {Chum salmon (Oncorhynchus keta) [TaxId: 8018]} ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvavrlgehnikvteg seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg wgntmsstadgdklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv vcngelqgvvswgygcaepgnpgvyakvcifndwltstmat
Timeline for d2zpra_: