SCOPe 2.07: Domain d2zpqa_: 2zpq A:

Lineage for d2zpqa_ (2zpq A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [189036] (3 PDB entries)

8. Domain d2zpqa_: 2zpq A: [171406]
   automated match to d1bita_
   complexed with ben, ca, so4

Details for d2zpqa_

PDB Entry: 2zpq, 1.9 Å

PDB Description: Crystal structure of anionic trypsin isoform 1 from chum salmon

PDB Compounds: (A:) anionic trypsin

SCOPe Domain Sequences for d2zpqa_:

Sequence; same for both SEQRES and ATOM records:

>d2zpqa_ b.47.1.2 (A:) automated matches {Chum salmon (Oncorhynchus keta) [TaxId: 8018]}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstma

Timeline for d2zpqa_:

• d2zpqa_ first appeared in SCOPe 2.01
  
• d2zpqa_ appears in SCOPe 2.06
  
• d2zpqa_ appears in the current release, SCOPe 2.08