Lineage for d2zpqa_ (2zpq A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 954551Protein automated matches [190044] (7 species)
    not a true protein
  7. 954557Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [189036] (3 PDB entries)
  8. 954561Domain d2zpqa_: 2zpq A: [171406]
    automated match to d1bita_
    complexed with ben, ca, so4

Details for d2zpqa_

PDB Entry: 2zpq (more details), 1.9 Å

PDB Description: Crystal structure of anionic trypsin isoform 1 from chum salmon
PDB Compounds: (A:) anionic trypsin

SCOPe Domain Sequences for d2zpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpqa_ b.47.1.2 (A:) automated matches {Chum salmon (Oncorhynchus keta) [TaxId: 8018]}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstma

SCOPe Domain Coordinates for d2zpqa_:

Click to download the PDB-style file with coordinates for d2zpqa_.
(The format of our PDB-style files is described here.)

Timeline for d2zpqa_: