![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [189036] (3 PDB entries) |
![]() | Domain d2zpqa_: 2zpq A: [171406] automated match to d1bita_ complexed with ben, ca, so4 |
PDB Entry: 2zpq (more details), 1.9 Å
SCOPe Domain Sequences for d2zpqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zpqa_ b.47.1.2 (A:) automated matches {Chum salmon (Oncorhynchus keta) [TaxId: 8018]} ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv vcngelqgvvswgygcaepgnpgvyakvcifndwltstma
Timeline for d2zpqa_: