![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.0: automated matches [191478] (1 protein) not a true family |
![]() | Protein automated matches [190767] (7 species) not a true protein |
![]() | Species Chelonia mydas [TaxId:8469] [188572] (1 PDB entry) |
![]() | Domain d2zpoa_: 2zpo A: [171405] automated match to d1k5ba_ complexed with gol, so4 |
PDB Entry: 2zpo (more details), 1.6 Å
SCOPe Domain Sequences for d2zpoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zpoa_ d.5.1.0 (A:) automated matches {Chelonia mydas [TaxId: 8469]} etryekflrqhvdyprtaapdtrtycnqmmqrrgmtlpvckftntfvhasaasitticgp ggapaggnlrdstasfalttcrlqggsqrppcnynggtstqririacdgglpvhydrai
Timeline for d2zpoa_: