Lineage for d2zpnc_ (2zpn C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502275Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2502297Protein automated matches [190358] (6 species)
    not a true protein
  7. 2502298Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188724] (3 PDB entries)
  8. 2502301Domain d2zpnc_: 2zpn C: [171403]
    automated match to d1eo6a_
    complexed with so4

Details for d2zpnc_

PDB Entry: 2zpn (more details), 2.7 Å

PDB Description: The crystal structure of Saccharomyces cerevisiae Atg8- Atg19(412-415) complex
PDB Compounds: (C:) Autophagy-related protein 8

SCOPe Domain Sequences for d2zpnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpnc_ d.15.1.3 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvgqfvyv
irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysg

SCOPe Domain Coordinates for d2zpnc_:

Click to download the PDB-style file with coordinates for d2zpnc_.
(The format of our PDB-style files is described here.)

Timeline for d2zpnc_: