Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
Protein automated matches [190358] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188724] (3 PDB entries) |
Domain d2zpnb_: 2zpn B: [171402] automated match to d1eo6a_ complexed with so4 |
PDB Entry: 2zpn (more details), 2.7 Å
SCOPe Domain Sequences for d2zpnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zpnb_ d.15.1.3 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvgqfvyv irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysge
Timeline for d2zpnb_: