Lineage for d2zpnb_ (2zpn B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932757Protein automated matches [190358] (6 species)
    not a true protein
  7. 2932758Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188724] (3 PDB entries)
  8. 2932760Domain d2zpnb_: 2zpn B: [171402]
    automated match to d1eo6a_
    complexed with so4

Details for d2zpnb_

PDB Entry: 2zpn (more details), 2.7 Å

PDB Description: The crystal structure of Saccharomyces cerevisiae Atg8- Atg19(412-415) complex
PDB Compounds: (B:) Autophagy-related protein 8

SCOPe Domain Sequences for d2zpnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpnb_ d.15.1.3 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvgqfvyv
irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysge

SCOPe Domain Coordinates for d2zpnb_:

Click to download the PDB-style file with coordinates for d2zpnb_.
(The format of our PDB-style files is described here.)

Timeline for d2zpnb_: