Lineage for d2zpna_ (2zpn A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018108Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
  6. 1018130Protein automated matches [190358] (5 species)
    not a true protein
  7. 1018131Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188724] (1 PDB entry)
  8. 1018132Domain d2zpna_: 2zpn A: [171401]
    automated match to d1eo6a_
    complexed with so4

Details for d2zpna_

PDB Entry: 2zpn (more details), 2.7 Å

PDB Description: The crystal structure of Saccharomyces cerevisiae Atg8- Atg19(412-415) complex
PDB Compounds: (A:) Autophagy-related protein 8

SCOPe Domain Sequences for d2zpna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpna_ d.15.1.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkstfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvgqf
vyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysg

SCOPe Domain Coordinates for d2zpna_:

Click to download the PDB-style file with coordinates for d2zpna_.
(The format of our PDB-style files is described here.)

Timeline for d2zpna_: