Class a: All alpha proteins [46456] (286 folds) |
Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) dimer of two identical helix-loop-helix subunits |
Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins) |
Protein SREBP-1a [47470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47471] (1 PDB entry) |
Domain d1am9a_: 1am9 A: [17140] protein/DNA complex; complexed with mg |
PDB Entry: 1am9 (more details), 2.3 Å
SCOPe Domain Sequences for d1am9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq klkqenlslrtavhkskslk
Timeline for d1am9a_: