Class a: All alpha proteins [46456] (179 folds) |
Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) dimer of two identical helix-loop-helix subunits |
Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins) |
Protein SREBP-1a [47470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47471] (1 PDB entry) |
Domain d1am9a_: 1am9 A: [17140] |
PDB Entry: 1am9 (more details), 2.3 Å
SCOP Domain Sequences for d1am9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens)} qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq klkqenlslrtavhkskslk
Timeline for d1am9a_: