Lineage for d1am9a_ (1am9 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280762Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 280763Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 280764Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins)
  6. 280794Protein SREBP-1a [47470] (1 species)
  7. 280795Species Human (Homo sapiens) [TaxId:9606] [47471] (1 PDB entry)
  8. 280796Domain d1am9a_: 1am9 A: [17140]

Details for d1am9a_

PDB Entry: 1am9 (more details), 2.3 Å

PDB Description: human srebp-1a bound to ldl receptor promoter

SCOP Domain Sequences for d1am9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens)}
qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
klkqenlslrtavhkskslk

SCOP Domain Coordinates for d1am9a_:

Click to download the PDB-style file with coordinates for d1am9a_.
(The format of our PDB-style files is described here.)

Timeline for d1am9a_: