SCOPe 2.04: Domain d2zpca_: 2zpc A:

Lineage for d2zpca_ (2zpc A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
   11 stranded sheet partly folded in a corner-like structure filled with a few short helices

4. Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families)

5. Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 proteins)
   automatically mapped to Pfam PF03548

6. Protein automated matches [190946] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188524] (2 PDB entries)

8. Domain d2zpca_: 2zpc A: [171399]
   automated match to d1iwla_
   mutant

Details for d2zpca_

PDB Entry: 2zpc, 2.35 Å

PDB Description: crystal structure of the r43l mutant of lola in the closed form

PDB Compounds: (A:) Outer-membrane lipoprotein carrier protein

SCOPe Domain Sequences for d2zpca_:

Sequence; same for both SEQRES and ATOM records:

>d2zpca_ b.125.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvklpnlfnwhmtqpdesilv
sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
rkl

Timeline for d2zpca_:

• d2zpca_ first appeared in SCOPe 2.01
  
• d2zpca_ appears in SCOPe 2.03
  
• d2zpca_ appears in SCOPe 2.05
  
• d2zpca_ appears in the current release, SCOPe 2.08, called d2zpca1