SCOPe 2.07: Domain d2zoyb2: 2zoy B:75-174

Lineage for d2zoyb2 (2zoy B:75-174)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Transcriptional regulator Cgl2612 [140895] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [140896] (5 PDB entries)
   Uniprot Q8NMG3 75-175

8. Domain d2zoyb2: 2zoy B:75-174 [171394]
   Other proteins in same PDB: d2zoya1, d2zoyb1
   automated match to d2zoya2
   complexed with gol

Details for d2zoyb2

PDB Entry: 2zoy, 1.9 Å

PDB Description: The multi-drug binding transcriptional repressor CgmR (CGL2612 protein) from C.glutamicum

PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d2zoyb2:

Sequence; same for both SEQRES and ATOM records:

>d2zoyb2 a.121.1.1 (B:75-174) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
edplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahkr
avylvqlaadglfvhdyihddvlskskrqamletilelip

Timeline for d2zoyb2:

• d2zoyb2 first appeared in SCOPe 2.01
  
• d2zoyb2 appears in SCOPe 2.06
  
• d2zoyb2 appears in the current release, SCOPe 2.08