Lineage for d2zoyb2 (2zoy B:75-174)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1096810Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1096811Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 1096812Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)
  6. 1097013Protein Transcriptional regulator Cgl2612 [140895] (1 species)
  7. 1097014Species Corynebacterium glutamicum [TaxId:1718] [140896] (2 PDB entries)
    Uniprot Q8NMG3 75-175
  8. 1097016Domain d2zoyb2: 2zoy B:75-174 [171394]
    Other proteins in same PDB: d2zoya1, d2zoyb1
    automatically matched to 1V7B A:75-175
    complexed with gol

Details for d2zoyb2

PDB Entry: 2zoy (more details), 1.9 Å

PDB Description: The multi-drug binding transcriptional repressor CgmR (CGL2612 protein) from C.glutamicum
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d2zoyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoyb2 a.121.1.1 (B:75-174) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
edplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahkr
avylvqlaadglfvhdyihddvlskskrqamletilelip

SCOPe Domain Coordinates for d2zoyb2:

Click to download the PDB-style file with coordinates for d2zoyb2.
(The format of our PDB-style files is described here.)

Timeline for d2zoyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zoyb1