Lineage for d2zoya2 (2zoy A:75-175)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340898Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2340899Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2340900Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2341231Protein Transcriptional regulator Cgl2612 [140895] (1 species)
  7. 2341232Species Corynebacterium glutamicum [TaxId:1718] [140896] (5 PDB entries)
    Uniprot Q8NMG3 75-175
  8. 2341237Domain d2zoya2: 2zoy A:75-175 [171392]
    Other proteins in same PDB: d2zoya1, d2zoyb1
    complexed with gol

Details for d2zoya2

PDB Entry: 2zoy (more details), 1.9 Å

PDB Description: The multi-drug binding transcriptional repressor CgmR (CGL2612 protein) from C.glutamicum
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2zoya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoya2 a.121.1.1 (A:75-175) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
edplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahkr
avylvqlaadglfvhdyihddvlskskrqamletilelips

SCOPe Domain Coordinates for d2zoya2:

Click to download the PDB-style file with coordinates for d2zoya2.
(The format of our PDB-style files is described here.)

Timeline for d2zoya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zoya1