Lineage for d2zoya1 (2zoy A:1-74)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1078588Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1078973Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
  6. 1079174Protein Transcriptional regulator Cgl2612 [140181] (1 species)
  7. 1079175Species Corynebacterium glutamicum [TaxId:1718] [140182] (2 PDB entries)
    Uniprot Q8NMG3 1-174
  8. 1079176Domain d2zoya1: 2zoy A:1-74 [171391]
    Other proteins in same PDB: d2zoya2, d2zoyb2
    complexed with gol

Details for d2zoya1

PDB Entry: 2zoy (more details), 1.9 Å

PDB Description: The multi-drug binding transcriptional repressor CgmR (CGL2612 protein) from C.glutamicum
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2zoya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoya1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
ddwdkelrditrdp

SCOPe Domain Coordinates for d2zoya1:

Click to download the PDB-style file with coordinates for d2zoya1.
(The format of our PDB-style files is described here.)

Timeline for d2zoya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zoya2