SCOPe 2.01: Domain d2zoya1: 2zoy A:1-74

Lineage for d2zoya1 (2zoy A:1-74)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Transcriptional regulator Cgl2612 [140181] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [140182] (2 PDB entries)
   Uniprot Q8NMG3 1-174

8. Domain d2zoya1: 2zoy A:1-74 [171391]
   Other proteins in same PDB: d2zoya2, d2zoyb2
   complexed with gol

Details for d2zoya1

PDB Entry: 2zoy, 1.9 Å

PDB Description: The multi-drug binding transcriptional repressor CgmR (CGL2612 protein) from C.glutamicum

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2zoya1:

Sequence; same for both SEQRES and ATOM records:

>d2zoya1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
ddwdkelrditrdp

Timeline for d2zoya1:

• d2zoya1 is new in SCOPe 2.01-stable
  
• d2zoya1 appears in SCOPe 2.02
  
• d2zoya1 appears in the current release, SCOPe 2.08