SCOP 1.57: Domain d1a0ab_: 1a0a B:

Lineage for d1a0ab_ (1a0a B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)

4. Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family)

5. Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (5 proteins)

6. Protein Pho4 B/HLH domain [47468] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47469] (1 PDB entry)

8. Domain d1a0ab_: 1a0a B: [17139]

Details for d1a0ab_

PDB Entry: 1a0a, 2.8 Å

PDB Description: phosphate system positive regulatory protein pho4/dna complex

SCOP Domain Sequences for d1a0ab_:

Sequence; same for both SEQRES and ATOM records:

>d1a0ab_ a.38.1.1 (B:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae)}
mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
gst

Timeline for d1a0ab_:

• d1a0ab_ first appeared (with stable ids) in SCOP 1.55
  
• d1a0ab_ appears in SCOP 1.59
  
• d1a0ab_ appears in the current release, SCOPe 2.08