Lineage for d1a0ab_ (1a0a B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47481Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
  4. 47482Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) (S)
  5. 47483Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (5 proteins)
  6. 47497Protein Pho4 B/HLH domain [47468] (1 species)
  7. 47498Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47469] (1 PDB entry)
  8. 47500Domain d1a0ab_: 1a0a B: [17139]

Details for d1a0ab_

PDB Entry: 1a0a (more details), 2.8 Å

PDB Description: phosphate system positive regulatory protein pho4/dna complex

SCOP Domain Sequences for d1a0ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0ab_ a.38.1.1 (B:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae)}
mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
gst

SCOP Domain Coordinates for d1a0ab_:

Click to download the PDB-style file with coordinates for d1a0ab_.
(The format of our PDB-style files is described here.)

Timeline for d1a0ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a0aa_