Lineage for d1a0ab_ (1a0a B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709988Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2709989Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2709990Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)
  6. 2710017Protein Pho4 B/HLH domain [47468] (1 species)
  7. 2710018Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47469] (1 PDB entry)
  8. 2710020Domain d1a0ab_: 1a0a B: [17139]
    protein/DNA complex

Details for d1a0ab_

PDB Entry: 1a0a (more details), 2.8 Å

PDB Description: phosphate system positive regulatory protein pho4/dna complex
PDB Compounds: (B:) protein (phosphate system positive regulatory protein pho4)

SCOPe Domain Sequences for d1a0ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0ab_ a.38.1.1 (B:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
gst

SCOPe Domain Coordinates for d1a0ab_:

Click to download the PDB-style file with coordinates for d1a0ab_.
(The format of our PDB-style files is described here.)

Timeline for d1a0ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a0aa_