![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
![]() | Protein automated matches [190498] (5 species) not a true protein |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [188785] (1 PDB entry) |
![]() | Domain d2zosb_: 2zos B: [171388] automated match to d1wzca1 |
PDB Entry: 2zos (more details), 1.7 Å
SCOPe Domain Sequences for d2zosb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zosb_ c.108.1.10 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle vik
Timeline for d2zosb_: