Lineage for d2zosb_ (2zos B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883530Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 1883601Protein automated matches [190498] (5 species)
    not a true protein
  7. 1883611Species Pyrococcus horikoshii [TaxId:53953] [188785] (1 PDB entry)
  8. 1883613Domain d2zosb_: 2zos B: [171388]
    automated match to d1wzca1

Details for d2zosb_

PDB Entry: 2zos (more details), 1.7 Å

PDB Description: crystal structure of mannosyl-3-phosphoglycerate phosphatase from pyrococcus horikoshii
PDB Compounds: (B:) Mannosyl-3-phosphoglycerate phosphatase

SCOPe Domain Sequences for d2zosb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zosb_ c.108.1.10 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
vik

SCOPe Domain Coordinates for d2zosb_:

Click to download the PDB-style file with coordinates for d2zosb_.
(The format of our PDB-style files is described here.)

Timeline for d2zosb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zosa_