Lineage for d2zosa1 (2zos A:1-243)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148975Family c.108.1.10: Predicted hydrolases Cof [82388] (12 protein domains)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2149046Protein automated matches [190498] (5 species)
    not a true protein
  7. 2149056Species Pyrococcus horikoshii [TaxId:53953] [188785] (1 PDB entry)
  8. 2149057Domain d2zosa1: 2zos A:1-243 [171387]
    Other proteins in same PDB: d2zosa2
    automated match to d1wzca1

Details for d2zosa1

PDB Entry: 2zos (more details), 1.7 Å

PDB Description: Crystal structure of mannosyl-3-phosphoglycerate phosphatase from Pyrococcus horikoshii
PDB Compounds: (A:) Mannosyl-3-phosphoglycerate phosphatase

SCOPe Domain Sequences for d2zosa1:

Sequence, based on SEQRES records: (download)

>d2zosa1 c.108.1.10 (A:1-243) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
vik

Sequence, based on observed residues (ATOM records): (download)

>d2zosa1 c.108.1.10 (A:1-243) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpevgnyivielgirvekireelkkleniyglkyygnstkeeiekf
tgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdkgkaaki
lldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvlevik

SCOPe Domain Coordinates for d2zosa1:

Click to download the PDB-style file with coordinates for d2zosa1.
(The format of our PDB-style files is described here.)

Timeline for d2zosa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zosa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2zosb_