Lineage for d2zocb_ (2zoc B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000111Protein automated matches [190368] (3 species)
    not a true protein
  7. 2000114Species Human (Homo sapiens) [TaxId:9606] [188886] (6 PDB entries)
  8. 2000116Domain d2zocb_: 2zoc B: [171383]
    automated match to d1anna_
    complexed with ca

Details for d2zocb_

PDB Entry: 2zoc (more details), 2 Å

PDB Description: Crystal structure of recombinant human annexin IV
PDB Compounds: (B:) Annexin A4

SCOPe Domain Sequences for d2zocb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zocb_ a.65.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkggtvkaasgfnamedaqtlrkamkglgtdedaiisvlayrntaqrqeirtaykstig
rdliddlkselsgnfeqvivgmmtptvlydvqelrramkgagtdegclieilasrtpeei
rrisqtyqqqygrsleddirsdtsfmfqrvlvslsaggrdegnylddalvrqdaqdlyea
gekkwgtdevkfltvlcsrnrnhllhvfdeykrisqkdieqsiksetsgsfedallaivk
cmrnksayfaeklyksmkglgtddntlirvmvsraeidmldirahfkrlygkslysfikg
dtsgdyrkvllvlcggdd

SCOPe Domain Coordinates for d2zocb_:

Click to download the PDB-style file with coordinates for d2zocb_.
(The format of our PDB-style files is described here.)

Timeline for d2zocb_: