Lineage for d2zoca_ (2zoc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717186Protein automated matches [190368] (3 species)
    not a true protein
  7. 2717189Species Human (Homo sapiens) [TaxId:9606] [188886] (10 PDB entries)
  8. 2717190Domain d2zoca_: 2zoc A: [171382]
    automated match to d1anna_
    complexed with ca

Details for d2zoca_

PDB Entry: 2zoc (more details), 2 Å

PDB Description: Crystal structure of recombinant human annexin IV
PDB Compounds: (A:) Annexin A4

SCOPe Domain Sequences for d2zoca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoca_ a.65.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matkggtvkaasgfnamedaqtlrkamkglgtdedaiisvlayrntaqrqeirtayksti
grdliddlkselsgnfeqvivgmmtptvlydvqelrramkgagtdegclieilasrtpee
irrisqtyqqqygrsleddirsdtsfmfqrvlvslsaggrdegnylddalvrqdaqdlye
agekkwgtdevkfltvlcsrnrnhllhvfdeykrisqkdieqsiksetsgsfedallaiv
kcmrnksayfaeklyksmkglgtddntlirvmvsraeidmldirahfkrlygkslysfik
gdtsgdyrkvllvlcggdd

SCOPe Domain Coordinates for d2zoca_:

Click to download the PDB-style file with coordinates for d2zoca_.
(The format of our PDB-style files is described here.)

Timeline for d2zoca_: