Lineage for d2znqb_ (2znq B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923773Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 923774Species Human (Homo sapiens) [TaxId:9606] [48527] (12 PDB entries)
  8. 923789Domain d2znqb_: 2znq B: [171381]
    automated match to d1gwxa_
    protein/DNA complex; complexed with 401, b7g

Details for d2znqb_

PDB Entry: 2znq (more details), 2.65 Å

PDB Description: human ppar delta ligand binding domain in complex with a synthetic agonist tipp401
PDB Compounds: (B:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d2znqb_:

Sequence, based on SEQRES records: (download)

>d2znqb_ a.123.1.1 (B:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
mpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvw
kqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhe
aifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdl
alfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrq
lvtehaqmmqrikktetetslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d2znqb_ a.123.1.1 (B:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
mpqvadlkafskhiynaylknfnmtkkkarsiltgapfvihdietlwqaekglvwlppyk
eisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivn
kdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcg
drpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqr
ikktetetslhpllqeiykd

SCOPe Domain Coordinates for d2znqb_:

Click to download the PDB-style file with coordinates for d2znqb_.
(The format of our PDB-style files is described here.)

Timeline for d2znqb_: