SCOPe 2.05: Domain d1a0aa_: 1a0a A:

Lineage for d1a0aa_ (1a0a A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)

6. Protein Pho4 B/HLH domain [47468] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47469] (1 PDB entry)

8. Domain d1a0aa_: 1a0a A: [17138]
   protein/DNA complex

Details for d1a0aa_

PDB Entry: 1a0a, 2.8 Å

PDB Description: phosphate system positive regulatory protein pho4/dna complex

PDB Compounds: (A:) protein (phosphate system positive regulatory protein pho4)

SCOPe Domain Sequences for d1a0aa_:

Sequence; same for both SEQRES and ATOM records:

>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
gst

Timeline for d1a0aa_:

• d1a0aa_ first appeared (with stable ids) in SCOP 1.55
  
• d1a0aa_ appears in SCOPe 2.04
  
• d1a0aa_ appears in SCOPe 2.06
  
• d1a0aa_ appears in the current release, SCOPe 2.08