Lineage for d1a0aa_ (1a0a A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442467Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 442468Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 442469Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 442497Protein Pho4 B/HLH domain [47468] (1 species)
  7. 442498Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47469] (1 PDB entry)
  8. 442499Domain d1a0aa_: 1a0a A: [17138]

Details for d1a0aa_

PDB Entry: 1a0a (more details), 2.8 Å

PDB Description: phosphate system positive regulatory protein pho4/dna complex

SCOP Domain Sequences for d1a0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae)}
mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
gst

SCOP Domain Coordinates for d1a0aa_:

Click to download the PDB-style file with coordinates for d1a0aa_.
(The format of our PDB-style files is described here.)

Timeline for d1a0aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a0ab_