Lineage for d1mdyc_ (1mdy C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537476Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 537477Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 537478Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 537500Protein Myod B/HLH domain [47464] (1 species)
  7. 537501Species Mouse (Mus musculus) [TaxId:10090] [47465] (1 PDB entry)
  8. 537504Domain d1mdyc_: 1mdy C: [17134]

Details for d1mdyc_

PDB Entry: 1mdy (more details), 2.8 Å

PDB Description: crystal structure of myod bhlh domain bound to dna: perspectives on dna recognition and implications for transcriptional activation

SCOP Domain Sequences for d1mdyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdyc_ a.38.1.1 (C:) Myod B/HLH domain {Mouse (Mus musculus)}
ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
rd

SCOP Domain Coordinates for d1mdyc_:

Click to download the PDB-style file with coordinates for d1mdyc_.
(The format of our PDB-style files is described here.)

Timeline for d1mdyc_: