SCOP 1.63: Domain d1mdyc_: 1mdy C:

Lineage for d1mdyc_ (1mdy C:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins)

6. Protein Myod B/HLH domain [47464] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47465] (1 PDB entry)

8. Domain d1mdyc_: 1mdy C: [17134]

Details for d1mdyc_

PDB Entry: 1mdy, 2.8 Å

PDB Description: crystal structure of myod bhlh domain bound to dna: perspectives on dna recognition and implications for transcriptional activation

SCOP Domain Sequences for d1mdyc_:

Sequence; same for both SEQRES and ATOM records:

>d1mdyc_ a.38.1.1 (C:) Myod B/HLH domain {Mouse (Mus musculus)}
ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
rd

Timeline for d1mdyc_:

• d1mdyc_ first appeared (with stable ids) in SCOP 1.55
  
• d1mdyc_ appears in SCOP 1.61
  
• d1mdyc_ appears in SCOP 1.65
  
• d1mdyc_ appears in the current release, SCOPe 2.08