![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
![]() | Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) ![]() dimer of two identical helix-loop-helix subunits |
![]() | Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins) |
![]() | Protein Myod B/HLH domain [47464] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47465] (1 PDB entry) |
![]() | Domain d1mdyc_: 1mdy C: [17134] protein/DNA complex |
PDB Entry: 1mdy (more details), 2.8 Å
SCOPe Domain Sequences for d1mdyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdyc_ a.38.1.1 (C:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall rd
Timeline for d1mdyc_: