Lineage for d1mdyb_ (1mdy B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213124Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 213125Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 213126Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins)
  6. 213146Protein Myod B/HLH domain [47464] (1 species)
  7. 213147Species Mouse (Mus musculus) [TaxId:10090] [47465] (1 PDB entry)
  8. 213149Domain d1mdyb_: 1mdy B: [17133]

Details for d1mdyb_

PDB Entry: 1mdy (more details), 2.8 Å

PDB Description: crystal structure of myod bhlh domain bound to dna: perspectives on dna recognition and implications for transcriptional activation

SCOP Domain Sequences for d1mdyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdyb_ a.38.1.1 (B:) Myod B/HLH domain {Mouse (Mus musculus)}
ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
rd

SCOP Domain Coordinates for d1mdyb_:

Click to download the PDB-style file with coordinates for d1mdyb_.
(The format of our PDB-style files is described here.)

Timeline for d1mdyb_: