SCOP 1.71: Domain d1mdya_: 1mdy A:

Lineage for d1mdya_ (1mdy A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)

6. Protein Myod B/HLH domain [47464] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47465] (1 PDB entry)

8. Domain d1mdya_: 1mdy A: [17132]

Details for d1mdya_

PDB Entry: 1mdy, 2.8 Å

PDB Description: crystal structure of myod bhlh domain bound to dna: perspectives on dna recognition and implications for transcriptional activation

SCOP Domain Sequences for d1mdya_:

Sequence; same for both SEQRES and ATOM records:

>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus)}
melkrkttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyie
glqallrd

Timeline for d1mdya_:

• d1mdya_ first appeared (with stable ids) in SCOP 1.55
  
• d1mdya_ appears in SCOP 1.69
  
• d1mdya_ appears in SCOP 1.73
  
• d1mdya_ appears in the current release, SCOPe 2.08