Lineage for d1mdya_ (1mdy A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442467Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 442468Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 442469Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 442491Protein Myod B/HLH domain [47464] (1 species)
  7. 442492Species Mouse (Mus musculus) [TaxId:10090] [47465] (1 PDB entry)
  8. 442493Domain d1mdya_: 1mdy A: [17132]

Details for d1mdya_

PDB Entry: 1mdy (more details), 2.8 Å

PDB Description: crystal structure of myod bhlh domain bound to dna: perspectives on dna recognition and implications for transcriptional activation

SCOP Domain Sequences for d1mdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus)}
melkrkttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyie
glqallrd

SCOP Domain Coordinates for d1mdya_:

Click to download the PDB-style file with coordinates for d1mdya_.
(The format of our PDB-style files is described here.)

Timeline for d1mdya_: