| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries) |
| Domain d2zkyg_: 2zky G: [171308] automated match to d1hl4a_ complexed with zn; mutant |
PDB Entry: 2zky (more details), 2.4 Å
SCOPe Domain Sequences for d2zkyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkyg_ b.1.8.1 (G:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq
Timeline for d2zkyg_: